Bacterial taxon 909946
Locus STM474_2030
Protein WP_000394196.1
translesion error-prone DNA polymerase V autoproteolytic subunit
Salmonella enterica Serovar Typhimurium ST4 74
Length 139 aa, Gene umuD, UniProt E8XB20
>WP_000394196.1|Salmonella enterica Serovar Typhimurium ST4 74|translesion error-prone DNA polymerase V autoproteolytic subunit
MEFFRPTELREIIPLPFFSYLVPCGFPSPAADYIEQRIDLNELLVSHPSSTYFVKASGDSMIEAGISDGDLLVVDSSRNADHGDIVIAAIEGEFTVKRLQLRPTVQLIPMNGAYRPIPVGSEDTLDIFGVVTFIIKAVS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,038,753 | -1.97 | 2.0e-8 | ●○○○○ -0.84 | -0.844610927884034 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,038,753 | -0.97 | 0.65 | ●○○○○ -0.33 | -0.325350475417136 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,038,753 | 0.82 | 0.48 | ○○○○○ 0.6 | 0.603921795125434 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)