Bacterial taxon 909946
Locus STM474_3797
Protein WP_001150163.1
transporter
Salmonella enterica Serovar Typhimurium ST4 74
Length 432 aa, Gene yhjV, UniProt E8XFE1
>WP_001150163.1|Salmonella enterica Serovar Typhimurium ST4 74|transporter
MQDDTLPLNNSNATTTPLSTRLPFTKYDFGWVLLCIGMAIGAGTVLMPVQIGLKGIWVFITAFIIAYPATYIVQDIYLKTLSESETCDDYTDIISHYLGKNWGIFLGVIYFLMIIHGVFIYSLSVVFDSASYIKTFGLTEADLSQSIIYKVAIFAVLVAIASGGEKLLFKISGPMVVVKVGIILIFGFAMIPHWNLDNISAFPAASVFFRDVLLTIPFCFFSAVFIQVLNPMNIAYRKREPDRVLATRMAIRTHRISYITLIAIILFFSFSFTFSISHEEAVSAFEQNISALALAAQVIPGHIIHITSTILNIFAVLTAFFGIYLGFHEALKGIVLNVLSRIMDVKNVNPLLLTSGICVFIVVTLVIWVSFRVSVLVFFQLGSPLYGIVACIIPFFLIYKVAQLEKLRGLKTWLILLYGILLCLSPLLKLIE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,830,636 | -5.89 | 2.2e-7 | ●●●○○ -2.88 | -2.88072191291038 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,831,156 | -5.75 | 9.1e-22 | ●●●○○ -2.81 | -2.80929739910679 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,830,956 | -3.4 | 1.6e-9 | ●●○○○ -1.59 | -1.59078101533889 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,831,104 | -3 | 3.3e-8 | ●●○○○ -1.38 | -1.38024754740005 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,831,498 | -2.98 | 0.001 | ●●○○○ -1.37 | -1.37268741612195 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,830,956 | -2.76 | 0.013 | ●●○○○ -1.26 | -1.25829295082889 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,830,469 | -2.49 | 0.01 | ●●○○○ -1.12 | -1.11805230916645 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,831,156 | -2.37 | 0.016 | ●●○○○ -1.06 | -1.05588525332175 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,830,469 | -2.1 | 0.00094 | ●○○○○ -0.92 | -0.915347345006595 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,831,498 | -1.97 | 0.0049 | ●○○○○ -0.85 | -0.847575921536196 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,830,636 | -1.69 | 0.0011 | ●○○○○ -0.7 | -0.69990694547905 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,830,636 | -2.09 | 0.08 | ●○○○○ -0.91 | -0.908323183912679 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,831,156 | -1.6 | 0.24 | ●○○○○ -0.65 | -0.651604762857865 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,831,498 | -1.43 | 0.32 | ●○○○○ -0.56 | -0.563358550999186 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,830,469 | -0.92 | 0.67 | ●○○○○ -0.3 | -0.299692939082038 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,831,104 | -0.76 | 0.75 | ●○○○○ -0.22 | -0.216970850857472 | 23637626 |
Retrieved 16 of 16 entries in 0.6 ms
(Link to these results)