Bacterial taxon 909946
Locus STM474_4548
Protein WP_000727896.1
transporter substrate-binding domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 246 aa, Gene n/a, UniProt E8XAN0
>WP_000727896.1|Salmonella enterica Serovar Typhimurium ST4 74|transporter substrate-binding domain-containing protein
MKKKLIVMLLASLSVHAASVSARTLHFGTSATYAPYEFVDADNKIVGFDIDVANAVCKEMQAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRKGAYHTFADLKGKKVGLENGTTHQRYLQDKQQAITPVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKNNPDYAIMDERASDPDYYGKGLGIAVRKDNDALLQEINAALDKVKASPEYAQMQEKWFTQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,616,628 | -0.22 | 0.87 | ○○○○○ 0.06 | 0.0616323115591574 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,616,628 | 0.67 | 0.87 | ○○○○○ 0.52 | 0.52312963152994 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,616,628 | 0.77 | 0.31 | ○○○○○ 0.58 | 0.577952136620669 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)