Bacterial taxon 909946
Locus STM474_4235
Protein WP_001091413.1
TRAP transporter small permease
Salmonella enterica Serovar Typhimurium ST4 74
Length 171 aa, Gene n/a, UniProt E8XKC0
>WP_001091413.1|Salmonella enterica Serovar Typhimurium ST4 74|TRAP transporter small permease
MNTFRKGLDLLLGAICCLVLAIMVGIACWQVVSRYILGVPSTLTEEMLRFLLVWVSMLGMAFVAGQKQHISLTLLLDKVSPTIRGWWDIILQVIFIAFSIWVLIIGGLKISAISMLQISPALGIPMGKIYYALPCAGVLIILYGLLNIVDALKAIHSATDTTEHTLEKSHD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,286,148 | -0.4 | 0.51 | ●○○○○ -0.03 | -0.0331283804784403 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,286,148 | 0.45 | 0.93 | ○○○○○ 0.41 | 0.410079037969935 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,286,148 | 3.2 | 0.21 | ○○○○○ 1.84 | 1.83859761669414 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)