Bacterial taxon 909946
Locus STM474_3917
Protein WP_001068438.1
tRNA (guanosine(18)-2'-O)-methyltransferase TrmH
Salmonella enterica Serovar Typhimurium ST4 74
Length 229 aa, Gene spoU, UniProt E8XGU3
>WP_001068438.1|Salmonella enterica Serovar Typhimurium ST4 74|tRNA (guanosine(18)-2'-O)-methyltransferase TrmH
MNPKRYARICEMLARRQPDLTVCMEQVHKPHNVSAIIRTADAVGVHEVHAIWPGSRMRTMASAAAGSNSWVQVKTHRTIGDAVAHLKSRGMQILATHLSDKAVDFREIDYTRPTCILMGQEKTGITQEALALADRDIIIPMIGMVQSLNVSVASALILYEAQRQRQNAGMYLRENSMLPEDEQQRLLFEGGYPVLAKVAKRKGLPYPRVNQQGEIDADADWWATMQAAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,957,638 | -6.12 | 1.2e-7 | ●●●○○ -3 | -2.99909257421267 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,957,638 | -4.49 | 2.9e-12 | ●●●○○ -2.15 | -2.15238973465818 | 23637626 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)