Bacterial taxon 909946
Locus STM474_3257
Protein WP_000786895.1
tRNA (guanosine(46)-N7)-methyltransferase TrmB
Salmonella enterica Serovar Typhimurium ST4 74
Length 239 aa, Gene trmb, UniProt E8XAF8
>WP_000786895.1|Salmonella enterica Serovar Typhimurium ST4 74|tRNA (guanosine(46)-N7)-methyltransferase TrmB
MKNDVISPEFDENGRPLRRIRSFVRRQGRLTKGQEHALENYWPVMGVEFSEAPVDFATLFGREAPVTLEIGFGMGASLVAMAKARPEQNFLGIEVHSPGVGACLASANEEGVENLRVMCHDAVEVLHKMIPDNSLSMVQLFFPDPWHKARHNKRRIVQVPFAELVLSKLKLGGVFHMATDWEAYAEHMLEVMSSIDGYKNLSESNDYVPRPESRPVTKFEQRGHRLGHGVWDLMFERVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,288,739 | -0.02 | 0.87 | ○○○○○ 0.16 | 0.164470878150925 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,288,739 | 1.29 | 0.61 | ○○○○○ 0.85 | 0.846139340812772 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,288,739 | 1.46 | 0.058 | ○○○○○ 0.94 | 0.936377025442795 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)