Bacterial taxon 909946
Locus STM474_3867
Protein WP_000932335.1
tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL
Salmonella enterica Serovar Typhimurium ST4 74
Length 157 aa, Gene yibK, UniProt E8XG09
>WP_000932335.1|Salmonella enterica Serovar Typhimurium ST4 74|tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL
MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRLRRAGLDYHEFAAVQRHHDYAAFVAAENPQRLFALTTKGTPAHSAVSYQDGDYLMFGPETRGLPASILDALPKEQKIRIPMMPDSRSMNLSNAVSVVVYEAWRQLGYPGAVLRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,910,918 | 0.29 | 0.86 | ○○○○○ 0.33 | 0.329613181106437 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,911,370 | 0.41 | 0.83 | ○○○○○ 0.39 | 0.38835265176574 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,910,918 | 0.43 | 0.93 | ○○○○○ 0.4 | 0.402371502843075 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,911,370 | 0.7 | 0.41 | ○○○○○ 0.54 | 0.538957473378309 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,911,370 | 1.06 | 0.7 | ○○○○○ 0.73 | 0.728030383491005 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,910,918 | 1.26 | 0.13 | ○○○○○ 0.83 | 0.830935932853613 | 23637626 |
Retrieved 6 of 6 entries in 1.8 ms
(Link to these results)