Bacterial taxon 909946
Locus STM474_3133
Protein WP_000117748.1
tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
Salmonella enterica Serovar Typhimurium ST4 74
Length 268 aa, Gene ygdL, UniProt E8X8S2
>WP_000117748.1|Salmonella enterica Serovar Typhimurium ST4 74|tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
MSVVISDAWRQRFGGTARLYGEKALQRFAEAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVIDDFITPDNVAGYMNAGFTYVIDAIDSVRPKAALIAYCRRYKVPLVTTGGAGGQIDPTQIQVADLAKTIQDPLAAKLRERLKHNFGVVKNSKGKLGVDCVFSTEALVYPQADGSVCAMKATAEGPKRMDCASGFGAATMVTATFGFVAVSHALKKIMAKAARQE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,160,678 | -0.33 | 0.81 | ○○○○○ 0.01 | 0.00642453362696101 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,161,018 | 0.36 | 0.61 | ○○○○○ 0.36 | 0.361736436564591 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,160,678 | 0.47 | 0.4 | ○○○○○ 0.42 | 0.422507033309497 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,160,678 | 0.54 | 0.89 | ○○○○○ 0.46 | 0.459041300242876 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,161,018 | 0.82 | 0.8 | ○○○○○ 0.6 | 0.601941512028415 | 23637626 |
Retrieved 5 of 5 entries in 1 ms
(Link to these results)