Bacterial taxon 909946
Locus STM474_3546
Protein WP_001219664.1
tRNA dihydrouridine synthase DusB
Salmonella enterica Serovar Typhimurium ST4 74
Length 321 aa, Gene yhdG, UniProt E8XD89
>WP_001219664.1|Salmonella enterica Serovar Typhimurium ST4 74|tRNA dihydrouridine synthase DusB
MRIGQYQLRNRLIAAPMAGITDRPFRTLCYEMGAGLTVSEMMSSNPQVWESDKSRLRMVHVDEPGIRTVQIAGSDPVEMADAARINVESGAQIIDINMGCPAKKVNRKLAGSALLQYPDLVKSILIGVVNAVDVPVTLKIRTGWAPEHRNCVEIAQLAEDCGIQALTIHGRTRACLFNGEAEYDSIRAVKQKVSIPIIANGDITNPHKARAVLDYTGADALMIGRAAQGRPWIFREIQHYLDTGELLPPLPLAEVKRLLCTHVRELHDFYGQAKGYRIARKHVSWYLQEHAPDDQFRRTFNAIEDASEQLEALEAYFENFA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,577,060 | -1.95 | 0.035 | ●○○○○ -0.84 | -0.837298381977097 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,577,060 | -0.73 | 0.12 | ●○○○○ -0.2 | -0.20300722163046 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,577,060 | 1.66 | 0.92 | ○○○○○ 1.04 | 1.03820242043606 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)