Bacterial taxon 909946
Locus STM474_2263
Protein WP_001264832.1
tRNA dihydrouridine(16) synthase DusC
Salmonella enterica Serovar Typhimurium ST4 74
Length 312 aa, Gene yohI, UniProt E8XD16
>WP_001264832.1|Salmonella enterica Serovar Typhimurium ST4 74|tRNA dihydrouridine(16) synthase DusC
MRVLLAPMEGVLDALVRELLTEVNDYDLCITEFVRVVDQLLPVKVFHRICPELHHASRTPSGTPVRIQLLGQHPQWLAENAARATALGSYGVDLNCGCPSKVVNGSGGGATLLKDPELIYQGAKAMRAAVPSHLPVTVKVRLGWDSGDRKFEIADAVQQAGASELVVHGRTKAQGYRAEHIDWQAIGEIRQRLTIPVIANGEILDWQSAQACMATSGCDAVMIGRGALNIPNLSRVVKYNEPRMPWPEVVTLLQKYTRLEKQGDTGLYHVARIKQWLGYLRKEYIEATELFQSIRALNRSSEIARAIQAIKI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,269,338 | -0.81 | 0.5 | ●○○○○ -0.24 | -0.241064388854295 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,269,338 | -0.17 | 0.96 | ○○○○○ 0.09 | 0.0913824727063146 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,269,338 | -0.1 | 0.86 | ○○○○○ 0.12 | 0.124224089468892 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,269,321 | 1.09 | 0.15 | ○○○○○ 0.75 | 0.745031961260327 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,268,949 | 1.17 | 0.09 | ○○○○○ 0.78 | 0.782908070444823 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,268,949 | 1.21 | 0.61 | ○○○○○ 0.81 | 0.805105582600394 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,269,321 | 1.24 | 0.6 | ○○○○○ 0.82 | 0.822394832163624 | 23637626 |
Retrieved 7 of 7 entries in 1.5 ms
(Link to these results)