Bacterial taxon 909946
Locus STM474_0647
Protein WP_000138788.1
two-component response regulator DpiA
Salmonella enterica Serovar Typhimurium ST4 74
Length 226 aa, Gene dpiA, UniProt E8X9Y5
>WP_000138788.1|Salmonella enterica Serovar Typhimurium ST4 74|two-component response regulator DpiA
MTEPLTLLIVEDETLLAEMHAEYIRHIPSFNQIWLAGNLAQARMMIDRFKPGLILLDNYLPDGKGITLLHELMQSRYPGGVVFTTAASDMETVAEAVRSGAFDYLVKPIAYERLGQTLTRYQQRRRMLASADSASQKQIDEMFNAYARGEPKGDLPTGIDALTLNAVMRLFADPTVRHTAETVAQALTISRTTSRRYLEYCASQHLIVAEIIHGKVGRPQRIYHGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 689,508 | -0.4 | 0.76 | ●○○○○ -0.03 | -0.0287217468263259 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 689,508 | 0.33 | 0.96 | ○○○○○ 0.35 | 0.347256781435303 | 23637626 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)