Bacterial taxon 909946
Locus STM474_0724
Protein WP_000186054.1
two-component system response regulator KdpE
Salmonella enterica Serovar Typhimurium ST4 74
Length 225 aa, Gene kdpE, UniProt E8XA55
>WP_000186054.1|Salmonella enterica Serovar Typhimurium ST4 74|two-component system response regulator KdpE
MTNVLIVEDEQAIRRFLRAALEGDGLRVYEAETLQRGLLEAATRKPDLIILDLGLPDGDGIDFIRDLRQWSAIPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHAASPCADPIVRFSGVTVDLAARLIHRGDEEIHLTPIEFRLLAVLLNNTGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPTRPRHFITETGIGYRFMP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 765,760 | -0.75 | 0.55 | ●○○○○ -0.21 | -0.209877400716033 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 765,760 | -0.52 | 0.4 | ●○○○○ -0.09 | -0.0919441145819892 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 765,999 | 1.1 | 0.14 | ○○○○○ 0.75 | 0.749454829729294 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 765,760 | 1.28 | 0.68 | ○○○○○ 0.84 | 0.840345792026839 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 765,999 | 1.28 | 0.68 | ○○○○○ 0.84 | 0.843557683996792 | 23637626 |
Retrieved 5 of 5 entries in 1.1 ms
(Link to these results)