Bacterial taxon 909946
Locus STM474_3330
Protein WP_001221574.1
two-component system response regulator QseB
Salmonella enterica Serovar Typhimurium ST4 74
Length 219 aa, Gene ygiX, UniProt E8XBA5
>WP_001221574.1|Salmonella enterica Serovar Typhimurium ST4 74|two-component system response regulator QseB
MRILLVEDDTLIGDGIKAGLSKMGFSVDWFTEGRPGKEALYSAPYDAVILDLTLPGMDGRDILREWREKGKQEPVLILTARDALAERVEGLRLGADDYLCKPFALIEVAARLEALVRRASGQASSELRHGQVTLNPGNLVATLAGEPLALKPKEFALLELLLRNKGRVLPRKLIEEKLYNWDDDVSSNAVEVHVHHLRRKLGSEFIRTVHGIGYTLGDA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,361,872 | 1.17 | 0.032 | ○○○○○ 0.79 | 0.785262627297489 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,362,131 | 1.82 | 0.022 | ○○○○○ 1.12 | 1.12008552404837 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,362,059 | 3.04 | 0.0014 | ○○○○○ 1.76 | 1.75710548176717 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,362,059 | -1.66 | 0.12 | ●○○○○ -0.69 | -0.685927984523488 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,362,131 | 0.17 | 0.99 | ○○○○○ 0.27 | 0.265218331574874 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,361,780 | 0.73 | 0.84 | ○○○○○ 0.55 | 0.553694225127907 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,361,780 | 0.96 | 0.1 | ○○○○○ 0.68 | 0.677625597344454 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,361,872 | 1.02 | 0.45 | ○○○○○ 0.71 | 0.707694841555819 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,361,872 | 1.03 | 0.72 | ○○○○○ 0.71 | 0.709472898306783 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,361,780 | 1.15 | 0.43 | ○○○○○ 0.77 | 0.772965890311961 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,362,059 | 1.21 | 0.61 | ○○○○○ 0.8 | 0.804679370621415 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,362,131 | 1.88 | 0.38 | ○○○○○ 1.15 | 1.15130738468956 | 23637626 |
Retrieved 12 of 12 entries in 0.5 ms
(Link to these results)