Bacterial taxon 909946
Locus STM474_1979
Protein WP_000611323.1
two-component system response regulator UvrY
Salmonella enterica Serovar Typhimurium ST4 74
Length 218 aa, Gene uvrY, UniProt E8XA90
>WP_000611323.1|Salmonella enterica Serovar Typhimurium ST4 74|two-component system response regulator UvrY
MINVLLVDDHELVRAGIRRILEDIKGIKVVGEACCGEDAVKWCRTNAVDVVLMDMNMPGIGGLEATRKIARSTADIKVIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVYSGQRYIASDIAQQMALSQIEPAKTETPFASLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNIHGDVELTHLAIRHGLCNAETLTSQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,995,842 | -0.04 | 0.91 | ○○○○○ 0.16 | 0.155010378002543 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,995,842 | 0.39 | 1 | ○○○○○ 0.38 | 0.381381629550796 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,995,842 | 0.65 | 0.59 | ○○○○○ 0.51 | 0.514192179457511 | 23637626 |
Retrieved 3 of 3 entries in 2 ms
(Link to these results)