Bacterial taxon 909946
Locus STM474_0564
Protein WP_000681030.1
type 1 fimbrial protein subunit FimA
Salmonella enterica Serovar Typhimurium ST4 74
Length 185 aa, Gene fimA, UniProt E8X918
>WP_000681030.1|Salmonella enterica Serovar Typhimurium ST4 74|type 1 fimbrial protein subunit FimA
MKHKLMTSTIASLMFVAGAAVAADPTPVSVSGGTIHFEGKLVNAACAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAANAAVAFSGQADNTNPNLLAVSSADNSTTATGVGIEILDNTSSPLKPDGATFSAKQSLVEGTNTLRFTARYKATAAATTPGQANADATFIMKYE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 603,659 | -5.29 | 6.1e-20 | ●●●○○ -2.57 | -2.5683268776306 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 603,659 | -2.19 | 0.071 | ●○○○○ -0.96 | -0.961686301942132 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 603,659 | -1.37 | 0.38 | ●○○○○ -0.53 | -0.53261610405303 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)