Bacterial taxon 909946
Locus STM474_0307
Protein WP_000994224.1
type I addiction module toxin, SymE family
Salmonella enterica Serovar Typhimurium ST4 74
Length 91 aa, Gene n/a, UniProt E8XIW0
>WP_000994224.1|Salmonella enterica Serovar Typhimurium ST4 74|type I addiction module toxin, SymE family
MNASGVSVRHINSETCMTACYSQIPSQHLKGDWQEEAGFETGHGVTVKISEGCLILIAETDEVRDLRKELYQVKKSMKHIKAGVNNVVNGD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 338,868 | -5.72 | 1.4e-7 | ●●●○○ -2.79 | -2.79465214230224 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 338,868 | -1.8 | 0.43 | ●○○○○ -0.76 | -0.759421903620186 | 23637626 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)