Bacterial taxon 909946
Locus STM474_4207
Protein WP_001259011.1
type II toxin-antitoxin system HigA family antitoxin
Salmonella enterica Serovar Typhimurium ST4 74
Length 148 aa, Gene n/a, UniProt E8XK92
>WP_001259011.1|Salmonella enterica Serovar Typhimurium ST4 74|type II toxin-antitoxin system HigA family antitoxin
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALNQHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,261,531 | 0.23 | 0.98 | ○○○○○ 0.3 | 0.295402461705019 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,261,531 | 0.62 | 0.81 | ○○○○○ 0.5 | 0.496947133444138 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,261,531 | 1.15 | 0.2 | ○○○○○ 0.77 | 0.773483378085181 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)