Bacterial taxon 909946
Locus STM474_1079
Protein WP_000938191.1
type III secretion system effector protease PipA
Salmonella enterica Serovar Typhimurium ST4 74
Length 226 aa, Gene pipA, UniProt E8XE43
>WP_000938191.1|Salmonella enterica Serovar Typhimurium ST4 74|type III secretion system effector protease PipA
MLPVTYRLIPQSGVSTYRLNTADTPVFPDIPEHAPNPSRLRLAHDSLAINSEFRLEPECVVEYLISGAGGIDPDTEIDDDTYDECYDELSSVLQNAYTQSETFRRLMNYAYEKELHDVEQRWLLGAGEAFETTVAQEHFKLSEGRKVICLNLDDSDDSYTEHYESNEGRQLFDTKRSFIHEVVHALTHLQDKEENHPRGPVVEYTNIILKEMGHPSPPRMVYIFNK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,132,150 | -1.97 | 0.067 | ●○○○○ -0.84 | -0.843826067810091 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,132,150 | -1.6 | 0.25 | ●○○○○ -0.65 | -0.651400958833684 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,132,150 | 0.41 | 0.61 | ○○○○○ 0.39 | 0.38878676719548 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)