Bacterial taxon 909946
Locus STM474_0304
Protein WP_001541863.1
type IV secretion protein Rhs
Salmonella enterica Serovar Typhimurium ST4 74
Length 246 aa, Gene n/a, UniProt E8XIV7
>WP_001541863.1|Salmonella enterica Serovar Typhimurium ST4 74|type IV secretion protein Rhs
MQQQGWRTYLYDAEQPYTPVASVTGKGESRQVWYYHTDVTGTPQEVTAADGTLVWAGYIRGFGENAADISNSGAYFHQPLRLPGQYFDDETGLHYNLFRYYAPECGRFVSQDPIGLAGGLNLYQYAPNPIRWIDPLGLAILEHQSNFDAARRTGFENAGMTNPEDVTFSKVDPKTGTVVEFKGPNGAKVAYDAPHADMDVTAGHDKPHVGWQSAGKRGSGGANRGNITYDGPQHPHRSDSKGDDKC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 337,259 | -0.64 | 0.81 | ●○○○○ -0.16 | -0.155645144584281 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 337,166 | -0.36 | 0.91 | ●○○○○ -0.01 | -0.011659163598617 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 337,259 | -0.06 | 0.97 | ○○○○○ 0.14 | 0.144799341367482 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 337,194 | -0.04 | 0.98 | ○○○○○ 0.16 | 0.15542333862775 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 337,259 | 0.18 | 0.84 | ○○○○○ 0.27 | 0.268215680611502 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 337,166 | 0.19 | 0.98 | ○○○○○ 0.28 | 0.276871278253544 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 337,166 | 0.24 | 0.75 | ○○○○○ 0.3 | 0.303959167802417 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 337,194 | 0.39 | 0.65 | ○○○○○ 0.38 | 0.38104220700617 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 337,287 | 1.15 | 0.78 | ○○○○○ 0.78 | 0.776525460372682 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 337,194 | 1.31 | 0.57 | ○○○○○ 0.86 | 0.855357097161142 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 337,287 | 1.61 | 0.18 | ○○○○○ 1.01 | 1.0137537345255 | 23637626 |
Retrieved 11 of 11 entries in 1.3 ms
(Link to these results)