Bacterial taxon 909946
Locus STM474_0293
Protein WP_000118732.1
type VI secretion system baseplate subunit TssK
Salmonella enterica Serovar Typhimurium ST4 74
Length 447 aa, Gene n/a, UniProt E8XIU6
>WP_000118732.1|Salmonella enterica Serovar Typhimurium ST4 74|type VI secretion system baseplate subunit TssK
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKLILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPESLARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAWIGLPLTRITGLNPDGRIDIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLTGSDNHGHEAAEVSDYLLLQILNRFEPLLTHLAKTPLAPEVLYRYLSELAGELSTYVRPQTRRPAEYKEYKHLTPYAGLKSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLAIKASMPTDVLLQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHIARYGGMAMHTAGEFPGLETELWGVRDK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 320,571 | 1.85 | 0.013 | ○○○○○ 1.14 | 1.13747556792539 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 319,773 | 0.06 | 0.85 | ○○○○○ 0.21 | 0.210001994816738 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 319,773 | 0.28 | 0.97 | ○○○○○ 0.32 | 0.324316268568989 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 320,571 | 0.36 | 0.95 | ○○○○○ 0.36 | 0.363126760999563 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 320,571 | 0.5 | 0.71 | ○○○○○ 0.44 | 0.435254735410247 | 23637626 |
Retrieved 5 of 5 entries in 0.8 ms
(Link to these results)