Bacterial taxon 909946
Locus STM474_0282
Protein WP_000806681.1
type VI secretion system-associated protein TagK
Salmonella enterica Serovar Typhimurium ST4 74
Length 300 aa, Gene n/a, UniProt E8XIT5
>WP_000806681.1|Salmonella enterica Serovar Typhimurium ST4 74|type VI secretion system-associated protein TagK
MKQDMWELRKIQSQGITDNAQYPAGTYIVFTAAAPYIPLFEQHGKDDIALSLVRHEEAWWIVNHSDELCCAVNEQVMEPHHRMRLNDGDTIEWGLSSWCLARTNDESRPDVSFPQLVQSSESVAEYLDLDWFKQQQLNPQNPFDIIPVRETASSYTGHEADSTLHQLYQEYQQALRPSGQEKPLRAKPFPRNEDAVTQDLTSLYDKKGDTDTLQDMVAGAPGIDAILDTLDTTGEGEMHWLAMESMPDILQLLSPELGGKTAHSEILPDLTRREHRIIGIDSHYRITPTQKNGNTAHEKN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 310,663 | -1.71 | 0.0074 | ●○○○○ -0.71 | -0.712769768228835 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 310,631 | -0.99 | 0.042 | ●○○○○ -0.34 | -0.335791449551155 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 310,440 | -0.79 | 0.14 | ●○○○○ -0.24 | -0.235493832771536 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 310,663 | -0.65 | 0.81 | ●○○○○ -0.16 | -0.159419599287415 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 310,440 | -0.51 | 0.69 | ●○○○○ -0.09 | -0.0856431864839074 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 310,663 | -0.09 | 0.95 | ○○○○○ 0.13 | 0.13092541752699 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 310,631 | 0.21 | 0.98 | ○○○○○ 0.29 | 0.287548887488495 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 310,631 | 0.47 | 0.72 | ○○○○○ 0.42 | 0.41894090741972 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 310,440 | 0.48 | 0.94 | ○○○○○ 0.43 | 0.428164016864248 | 23637626 |
Retrieved 9 of 9 entries in 1.1 ms
(Link to these results)