Bacterial taxon 909946
Locus STM474_3759
Protein WP_000323565.1
universal stress protein UspA
Salmonella enterica Serovar Typhimurium ST4 74
Length 144 aa, Gene uspA, UniProt E8XFA4
>WP_000323565.1|Salmonella enterica Serovar Typhimurium ST4 74|universal stress protein UspA
MAYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISEETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,782,559 | -0.65 | 0.8 | ●○○○○ -0.16 | -0.160380092119793 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,782,559 | 0.34 | 0.65 | ○○○○○ 0.35 | 0.353246481104354 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,782,418 | 1.03 | 0.2 | ○○○○○ 0.71 | 0.711053383329549 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,782,418 | 1.52 | 0.44 | ○○○○○ 0.97 | 0.966071369085644 | 23637626 |
Retrieved 4 of 4 entries in 1.5 ms
(Link to these results)