Bacterial taxon 909946
Locus STM474_1664
Protein WP_001082296.1
universal stress protein UspF
Salmonella enterica Serovar Typhimurium ST4 74
Length 144 aa, Gene n/a, UniProt E8XJY2
>WP_001082296.1|Salmonella enterica Serovar Typhimurium ST4 74|universal stress protein UspF
MNRTILVPIDISDSELTQRVISHVEAEAKIDDAKVHFLTVIPSLPYYASLGLAYSAELPAMDDLKAEAKSQLEAIIKKFNLPADRVQAHVAEGSPKDKILEMAKKLPADMVIIASHRPDITTYLLGSNAAAVVRHAECSVLVVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,703,319 | -2.11 | 0.097 | ●○○○○ -0.92 | -0.916461458923583 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,703,257 | -0.45 | 0.59 | ●○○○○ -0.06 | -0.0567885212577852 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,703,319 | 0.06 | 0.92 | ○○○○○ 0.21 | 0.210471281355367 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,703,257 | 0.13 | 1 | ○○○○○ 0.25 | 0.245483536026464 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,703,319 | 0.28 | 0.97 | ○○○○○ 0.32 | 0.320965872765994 | 23637626 |
Retrieved 5 of 5 entries in 1.4 ms
(Link to these results)