Bacterial taxon 909946
Locus STM474_0634
Protein WP_000278499.1
universal stress protein UspG
Salmonella enterica Serovar Typhimurium ST4 74
Length 142 aa, Gene ybdQ, UniProt E8X985
>WP_000278499.1|Salmonella enterica Serovar Typhimurium ST4 74|universal stress protein UspG
MYKTIIMPVDVFEMELSDKAIRHAEFLAQQDGVIHLLHVLPGSASMSLHRFAADVRRFEEHLQHEAETRLQTMVGHFSIDPSRIKTHVRFGSVRDVVNEMGEELDADVVVIGSRNPSITTHLLGSNASSVVRHATLPVLVVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 677,196 | -1.69 | 0.022 | ●○○○○ -0.7 | -0.698579482013967 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 677,196 | -0.67 | 0.79 | ●○○○○ -0.17 | -0.172908919163803 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 677,196 | -0.06 | 0.98 | ○○○○○ 0.15 | 0.146322786938397 | 23637626 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)