Bacterial taxon 909946
Locus STM474_2022
Protein WP_000785978.1
very short patch repair endonuclease
Salmonella enterica Serovar Typhimurium ST4 74
Length 156 aa, Gene vsr, UniProt E8XB12
>WP_000785978.1|Salmonella enterica Serovar Typhimurium ST4 74|very short patch repair endonuclease
MADVHDKATRSKNMRAIATRDTAIEKRLAGLLSAQGITFHTQDATLPGKPDFVVNDYDCVIFTHGCFWHHHHCYLFKVPATRTAFWLEKIGKNVERDERDIQRLQALGWRVLIVWECALRGRAKLSDAALAERLEEWICGGGASAQIDTQGIHLLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,031,574 | 1.5 | 0.037 | ○○○○○ 0.96 | 0.955999118271518 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,031,574 | -0.6 | 0.63 | ●○○○○ -0.14 | -0.136387684433383 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,031,574 | -0.21 | 0.95 | ○○○○○ 0.07 | 0.0676124303908948 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)