Bacterial taxon 909946
Locus STM474_2915
Protein WP_000178733.1
VirK family antimicrobial peptide resistance protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 309 aa, Gene virK, UniProt E8XK21
>WP_000178733.1|Salmonella enterica Serovar Typhimurium ST4 74|VirK family antimicrobial peptide resistance protein
MTMQQSDMERYNPLLMLKEVMAQTPYRHKRWGERKFRYKFLLRCLINPVTTIKYFNELCHLSQPRTLIIHRPLLPAKIQRPYLYTGLSIRCRAKAILEHYQFVQSFPESKIKKILLSEEQILLAHLEGKNGALVDIYCGPCGYDREGELTLTLCFNDTPLARLSFSFIRHEGKQIALVAGLQGPSKHIGPQVIRNATKDCYGLFPKRMLYEAFATLMQACNVDEIYAVSENNHVYRQLRYLFQKKKTFVASYSEFWESLNGVKKGALYHLPSQVMRKAPESIPSKKRAEYRKRYHILDTIIQEVNSLSR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,951,638 | -7.44 | 1.9e-44 | ●●●●○ -3.68 | -3.68446042826973 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,951,839 | -7.12 | 5.1e-8 | ●●●●○ -3.52 | -3.51925264024704 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,951,638 | -7.05 | 1.9e-8 | ●●●●○ -3.48 | -3.48400639794146 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,951,839 | -6.38 | 6.5e-25 | ●●●●○ -3.13 | -3.13468724512757 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,951,638 | -4.61 | 2.0e-5 | ●●●○○ -2.21 | -2.21471004183541 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,951,839 | -4.5 | 2.4e-5 | ●●●○○ -2.16 | -2.16008903293423 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,951,214 | -2.32 | 8.5e-5 | ●●○○○ -1.03 | -1.02582746051933 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,951,214 | -1.82 | 0.00028 | ●○○○○ -0.77 | -0.769541541902732 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,951,214 | -1.48 | 0.31 | ●○○○○ -0.59 | -0.589877862073133 | 23637626 |
Retrieved 9 of 9 entries in 1.3 ms
(Link to these results)