Bacterial taxon 909946
Locus STM474_0244
Protein WP_000901088.1
VOC family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 129 aa, Gene yaer, UniProt E8XIQ5
>WP_000901088.1|Salmonella enterica Serovar Typhimurium ST4 74|VOC family protein
MLGLKQVHHIAIIATDYAVSKAFYCDILGFDLLSEVWREERDSWKGDLALNGQYVIELFSFPFPPARPSRPEACGLRHLAFSVENVENAVAHLEKHQVKCEPIRIDPYTGKRFTFFNDPDGLPLELYEQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 278,265 | 0.43 | 0.93 | ○○○○○ 0.4 | 0.401615957565898 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 278,265 | 0.74 | 0.38 | ○○○○○ 0.56 | 0.562703427799644 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 278,265 | 1.36 | 0.58 | ○○○○○ 0.88 | 0.884814084894223 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)