Bacterial taxon 909946
Locus STM474_2883
Protein WP_010989065.1
XRE family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 118 aa, Gene n/a, UniProt E8XJA8
>WP_010989065.1|Salmonella enterica Serovar Typhimurium ST4 74|XRE family transcriptional regulator
MPEDGCCPERDNSCMFRCRIAIVIGKRLKISRVRADLTQAELGALAGLDEESASARISSYEKEVHAPDFKLVCKLAAALDVPEAYFYAVDDELAELILQYHRFKKNNPGSTLILSGNI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,911,061 | -0.03 | 0.87 | ○○○○○ 0.16 | 0.161435996681365 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,911,061 | 1.51 | 0.72 | ○○○○○ 0.96 | 0.961070437377661 | 23637626 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)