Bacterial taxon 909946
Locus STM474_4222
Protein WP_010989088.1
XRE family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 188 aa, Gene n/a, UniProt E8XKA7
>WP_010989088.1|Salmonella enterica Serovar Typhimurium ST4 74|XRE family transcriptional regulator
MNVGCFMTQPISVIARSLVRERQRTGLSLAEIARRAGIAKSTLSQLEAGNGNPSLETLWSLCVALDIPFARLLEPQVQKTQVIRRGEGTKVVAEQAHYQAILLAACPPGARRDIYLLLTQPGADRISHPHPPGSVEHIIVTQGKALVGLTEAPEELAEGDYICYPGDQAHIFKALEPDTQAILVAEQN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,274,392 | -1.41 | 0.19 | ●○○○○ -0.56 | -0.556809815782548 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,274,392 | -0.44 | 0.56 | ●○○○○ -0.05 | -0.0494730921155095 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,274,828 | 0.45 | 0.56 | ○○○○○ 0.41 | 0.408391574633667 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,274,828 | 0.9 | 0.77 | ○○○○○ 0.65 | 0.645176060081411 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,274,392 | 1 | 0.73 | ○○○○○ 0.7 | 0.698377747052143 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,274,828 | 1.68 | 0.18 | ○○○○○ 1.05 | 1.04951720546625 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)