Bacterial taxon 909946
Locus STM474_0248
Protein WP_001185319.1
YaeQ family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 181 aa, Gene yaeq, UniProt E8XIQ9
>WP_001185319.1|Salmonella enterica Serovar Typhimurium ST4 74|YaeQ family protein
MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLLAWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVALFAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWLSDARNNLEIQLTAWQQPS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 280,916 | 0.59 | 0.62 | ○○○○○ 0.48 | 0.48220480425442 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 280,916 | 1.35 | 0.077 | ○○○○○ 0.88 | 0.880183018479208 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 280,916 | 1.89 | 0.26 | ○○○○○ 1.16 | 1.16104463959775 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)