Bacterial taxon 909946
Locus STM474_0505
Protein WP_000467098.1
YbaB/EbfC family nucleoid-associated protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 109 aa, Gene ybaB, UniProt E8X871
>WP_000467098.1|Salmonella enterica Serovar Typhimurium ST4 74|YbaB/EbfC family nucleoid-associated protein
MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPGFKMPF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 542,599 | -3.11 | 0.015 | ●●○○○ -1.44 | -1.43577618133692 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 542,599 | -2.81 | 2.9e-8 | ●●○○○ -1.28 | -1.2806084232464 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 542,599 | -1.69 | 0.52 | ●○○○○ -0.7 | -0.698726557655816 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)