Bacterial taxon 909946
Locus STM474_4753
Protein WP_000058276.1
YbaK/EbsC family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 152 aa, Gene n/a, UniProt E8XCJ5
>WP_000058276.1|Salmonella enterica Serovar Typhimurium ST4 74|YbaK/EbsC family protein
MSLQSVRQFLADHAPDIEIIELNQSTATVELAAKAHNVEPGQIAKTLSLKVKDTIILVVAKGDARLDNKKLKTTFGAKARMLSSDEVVNATGHPVGGVCPFGLEHPLPVYCDISLKGYNEVLPAAGATHSAVRITPERMAELTSATWVDVCQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,828,127 | -1.25 | 0.039 | ●○○○○ -0.47 | -0.470010463556095 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,828,127 | 0.84 | 0.61 | ○○○○○ 0.61 | 0.611930614323706 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,828,127 | 0.91 | 0.76 | ○○○○○ 0.65 | 0.651052887214861 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)