Bacterial taxon 909946
Locus STM474_1285
Protein WP_000829539.1
YbaK/prolyl-tRNA synthetase associated domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 175 aa, Gene n/a, UniProt E8XFL0
>WP_000829539.1|Salmonella enterica Serovar Typhimurium ST4 74|YbaK/prolyl-tRNA synthetase associated domain-containing protein
MAEMTEVAKGVATHQRLVALLTQENARYRVVNHEAVGKCEAVSEIRGTALGQGAKALVCKVKGNGVNQHVLAILAADQQADLSQLASHLGGLRASLASPAEVDMLTGCVFGAIPPFSFHPNLKLVADPLLFERFDEIAFNAGLLEKSVIMNTQDYLRIARPELAVFRRFQSSPTA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,314,992 | -1.93 | 0.17 | ●○○○○ -0.82 | -0.824364901785494 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,314,929 | -0.24 | 0.86 | ○○○○○ 0.05 | 0.0524073658177709 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,314,992 | 0.04 | 0.97 | ○○○○○ 0.2 | 0.197266172040263 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,314,929 | 0.65 | 0.87 | ○○○○○ 0.51 | 0.514324846193072 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,314,992 | 1.59 | 0.41 | ○○○○○ 1 | 1.00112051639394 | 23637626 |
Retrieved 5 of 5 entries in 1.1 ms
(Link to these results)