Bacterial taxon 909946
Locus STM474_3985
Protein WP_001541156.1
YceK/YidQ family lipoprotein
Salmonella enterica Serovar Typhimurium ST4 74
Length 111 aa, Gene yidQ, UniProt E8XHP6
>WP_001541156.1|Salmonella enterica Serovar Typhimurium ST4 74|YceK/YidQ family lipoprotein
MMIKNVWLTLIIWNGMLLLSGCSSVMSHTGGKEGTYPGTRASATMIGNDETNWGTKSLAILDMPFTAVMDTILLPWDIFRKDSSVRSRVEKSEEETKMTNAVIPPAKMPPP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,032,127 | 1.02 | 0.66 | ○○○○○ 0.71 | 0.708621282402533 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,032,127 | 1.04 | 0.7 | ○○○○○ 0.72 | 0.716337208097363 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,032,127 | 1.04 | 0.19 | ○○○○○ 0.72 | 0.716801816129659 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)