Bacterial taxon 909946
Locus STM474_4698
Protein WP_000484490.1
YebC/PmpR family DNA-binding transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 241 aa, Gene yeeN, UniProt E8XCE0
>WP_000484490.1|Salmonella enterica Serovar Typhimurium ST4 74|YebC/PmpR family DNA-binding transcriptional regulator
MFPVGRKWANIVAKKTAKDGATSKVYAKFGVEIYAAAKQGEPDPESNSALKFVIERAKQAQVPKHVIDKAIDKAKGGGDETFVQGRYEGFGPNGSMVIAETLTSNVNRTIANIRTIFNKKGGNIGAAGAVSYMFDNTGVIVFKGTDPDHIFEILLDAEVDVRDVTEEEGNIVIYTEATDLHKGIAALKAAGISEFSTTELEMIAQSEVELSPEDLEIFEGLVDALEDDDDVQKVYHNVANL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,773,423 | -2.6 | 8.4e-6 | ●●○○○ -1.18 | -1.17539677117198 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,773,836 | -2.36 | 4.9e-5 | ●●○○○ -1.05 | -1.04746373263632 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,773,836 | -2.31 | 0.01 | ●●○○○ -1.02 | -1.02334138150076 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,773,690 | -1.57 | 0.7 | ●○○○○ -0.64 | -0.639928923747602 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,773,794 | -0.92 | 0.22 | ●○○○○ -0.3 | -0.30148287204139 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,773,794 | -0.61 | 0.71 | ●○○○○ -0.14 | -0.139307256742664 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,773,794 | -0.22 | 0.95 | ○○○○○ 0.06 | 0.0645139546790573 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,773,836 | -0.09 | 0.97 | ○○○○○ 0.13 | 0.132873221123325 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,773,423 | 0.16 | 1 | ○○○○○ 0.26 | 0.259683439430677 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,773,690 | 0.63 | 0.89 | ○○○○○ 0.5 | 0.504326170850188 | 23637626 |
Retrieved 10 of 10 entries in 2.4 ms
(Link to these results)