Bacterial taxon 909946
Locus STM474_2766
Protein WP_001264473.1
YfiM family lipoprotein
Salmonella enterica Serovar Typhimurium ST4 74
Length 107 aa, Gene yfiM, UniProt E8XIC5
>WP_001264473.1|Salmonella enterica Serovar Typhimurium ST4 74|YfiM family lipoprotein
MRVLIPFTVLFLSGCSHLANDHWSGQDKAQHFMASAMLSAAGNEYARHQGVSPDRSAAIGLMFSLSLGASKELWDSRPEGSGWSWKDFVWDVAGATTGYAIWQMARY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,794,497 | -0.45 | 0.88 | ●○○○○ -0.06 | -0.0585577823752961 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,794,497 | 0.59 | 0.65 | ○○○○○ 0.48 | 0.484143471546844 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,794,497 | 0.66 | 0.4 | ○○○○○ 0.52 | 0.519249781384576 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)