Bacterial taxon 909946
Locus STM474_3248
Protein WP_000997812.1
YggS family pyridoxal phosphate-dependent enzyme
Salmonella enterica Serovar Typhimurium ST4 74
Length 234 aa, Gene yggS, UniProt E8XAE9
>WP_000997812.1|Salmonella enterica Serovar Typhimurium ST4 74|YggS family pyridoxal phosphate-dependent enzyme
MNDIAHNLAYIRDKISAAATRCGRSSEEVTLLAVSKTKPASDIAEAIAAGQRAFGENYVQEGVEKIRHFQEAKVEGLHWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIASRLSEQRPDNLPALNVLIQINISDENSKSGIPLAELDELAAAVATLPRLRLRGLMAIPAPESDYVRQFEVARQMAVAFAGLKARYPDVDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYTKN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,281,948 | -0.23 | 0.95 | ○○○○○ 0.06 | 0.055364963908971 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,281,948 | -0.21 | 0.93 | ○○○○○ 0.07 | 0.0696893792496588 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,281,948 | 0.18 | 0.77 | ○○○○○ 0.27 | 0.272826850521556 | 23637626 |
Retrieved 3 of 3 entries in 0.6 ms
(Link to these results)