Bacterial taxon 909946
Locus STM474_3495
Protein WP_000979905.1
YhcH/YjgK/YiaL family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 155 aa, Gene yhcH, UniProt E8XD38
>WP_000979905.1|Salmonella enterica Serovar Typhimurium ST4 74|YhcH/YjgK/YiaL family protein
MMMGEVQSLPSCGLHPRLLDALTLALAARPQEKAPGRYELQGDNVFMNVMQLTTQMPAEKKAELHEQYIDIQLLLTGVERIAFGMSGAARQCEEMHVEEDYQLCSQIVDEQTITLQAGMFAVFMPGEPHKPGCAVGEPDDIKKVVVKVRASLLAA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,526,302 | 0.68 | 0.95 | ○○○○○ 0.53 | 0.528346587776152 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,526,302 | 1.35 | 0.55 | ○○○○○ 0.88 | 0.878560277336794 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,526,302 | 1.47 | 0.065 | ○○○○○ 0.94 | 0.938402182005664 | 23637626 |
Retrieved 3 of 3 entries in 1 ms
(Link to these results)