Bacterial taxon 909946
Locus STM474_3841
Protein WP_000576056.1
YhcH/YjgK/YiaL family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 154 aa, Gene yiaL, UniProt E8XFY3
>WP_000576056.1|Salmonella enterica Serovar Typhimurium ST4 74|YhcH/YjgK/YiaL family protein
MIFGHIAQPDPCRLPSAIEQALDFLRNTDFRTLEPGVVEIDGKNIFAQIIDMTTRDAAENRPEVHRRYLDIQFLAWGEEKIGVAIDTGNNQISESLLEQRDIIFYHDSEHESFIEMIPGSYALFFPQDVHRPGCNKSIATPIRKIVVKVAIDVL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,877,996 | -4.54 | 3.9e-5 | ●●●○○ -2.18 | -2.17965275686541 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,877,996 | -3.74 | 0.00036 | ●●○○○ -1.77 | -1.76518218515414 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,877,996 | -3.49 | 1.1e-10 | ●●○○○ -1.64 | -1.63752467995007 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)