Bacterial taxon 909946
Locus STM474_2258
Protein WP_001017057.1
YIP1 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 195 aa, Gene yohC, UniProt E8XD11
>WP_001017057.1|Salmonella enterica Serovar Typhimurium ST4 74|YIP1 family protein
MNHVWGLFSHPDREMQVIKSENETVSHHYTHHVLLMAAIPVVCAFIGTTQIGWNFGDGNVLQLSLFTAFALAVLFYGVMLAGVAVMGRVIWWMARNYPQRPSLARCMVFAGYVATPLFLSGLVALYPLVWLCALVGAVALFYTGYLLYLGIPTFLNINREEGLSFSSSTLAIGVLVLEVLLAITVILWGYGYRLF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,264,544 | -0.99 | 0.43 | ●○○○○ -0.34 | -0.338286840921336 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,264,544 | 0.51 | 0.91 | ○○○○○ 0.44 | 0.440191406595164 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,264,544 | 0.53 | 0.5 | ○○○○○ 0.45 | 0.452187568373876 | 23637626 |
Retrieved 3 of 3 entries in 1.7 ms
(Link to these results)