Bacterial taxon 909946
Locus STM474_4444
Protein WP_000270393.1
YjbQ family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 138 aa, Gene yjbQ, UniProt E8X912
>WP_000270393.1|Salmonella enterica Serovar Typhimurium ST4 74|YjbQ family protein
MWYQRTITLSEKPRGFHLITDEITDKLSGLPPVETGLLHLLLLHTSASLTLNENCDPTVRADMERHFLKTVPDNAAYEHDYEGADDMPSHIKSSVLGVSLLLPVRQGRLQLGTWQGIWLGEHRIHGGPRKIIATLQGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,492,818 | -0.51 | 0.5 | ●○○○○ -0.09 | -0.0855802803336372 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,492,947 | 0.53 | 0.7 | ○○○○○ 0.45 | 0.453699418685669 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,492,818 | 0.94 | 0.94 | ○○○○○ 0.66 | 0.664252869335711 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,492,947 | 1.24 | 0.59 | ○○○○○ 0.82 | 0.819641259843992 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,493,224 | 1.6 | 0.7 | ○○○○○ 1.01 | 1.00639742544759 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,493,224 | 1.61 | 0.21 | ○○○○○ 1.01 | 1.01401628966286 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,492,818 | 2.02 | 0.39 | ○○○○○ 1.23 | 1.22787009650719 | 23637626 |
Retrieved 7 of 7 entries in 1.8 ms
(Link to these results)