Bacterial taxon 909946
Locus STM474_1750
Protein WP_000114955.1
YkgJ family cysteine cluster protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 134 aa, Gene n/a, UniProt E8XKV0
>WP_000114955.1|Salmonella enterica Serovar Typhimurium ST4 74|YkgJ family cysteine cluster protein
MSVLNPCMTCGACCAYFRVSFYWAEGDDASGRVPASLTEPVTPFLRCMAGTNQKQPHCKALIGTPGENVSCAIYENRPSTCREFSISGEGGEVNEACNRARARYGLPPLYKDMLFHTTADAATVELSRVQLPAN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,786,071 | -1.81 | 0.2 | ●○○○○ -0.76 | -0.762710009699486 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,786,071 | -0.67 | 0.79 | ●○○○○ -0.17 | -0.171811439936003 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,786,071 | 0.06 | 0.94 | ○○○○○ 0.21 | 0.210855240849902 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)