Bacterial taxon 909946
Locus STM474_4358
Protein WP_000828129.1
zinc resistance sensor/chaperone ZraP
Salmonella enterica Serovar Typhimurium ST4 74
Length 151 aa, Gene zraP, UniProt E8XLB8
>WP_000828129.1|Salmonella enterica Serovar Typhimurium ST4 74|zinc resistance sensor/chaperone ZraP
MKRNNKSAIALIALSLLALSSGAAFAGHHWGNNDGMWQQGGSPLTTEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQKLDEQRVKRDVAMAQAGIPRGAGMGYGGCGGYGGGYHRGGGHMGMGNW
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,409,335 | -1.31 | 0.068 | ●○○○○ -0.5 | -0.501538350131424 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,409,335 | 1.1 | 0.67 | ○○○○○ 0.75 | 0.750244942671654 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,409,335 | 1.21 | 0.54 | ○○○○○ 0.8 | 0.804146349625533 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)