Bacterial taxon 909946
Locus STM474_3577
Protein WP_000285586.1
Zn(2+)-responsive transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 141 aa, Gene zntR, UniProt E8XDV6
>WP_000285586.1|Salmonella enterica Serovar Typhimurium ST4 74|Zn(2+)-responsive transcriptional regulator
MYRIGELAKLADVTPDTIRYYEKQQMMDHEVRTEGGFRLYTENDLQRLKFIRYARQLGFTLDSIRELLSIRIDPEHHTCQESKSIVQERLQEVEARIAELQTMQRSLQRLNDACCGTAHSSVYCSILEALEQGASGAKSGY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,603,518 | -0.29 | 0.93 | ○○○○○ 0.03 | 0.0278198530604144 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,603,518 | 0.14 | 0.93 | ○○○○○ 0.25 | 0.250373904072101 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,603,472 | 0.61 | 0.28 | ○○○○○ 0.5 | 0.495627706893699 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,603,518 | 0.72 | 0.4 | ○○○○○ 0.55 | 0.550551649729157 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,603,472 | 1.4 | 0.46 | ○○○○○ 0.91 | 0.906139926768909 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,603,472 | 2.04 | 0.2 | ○○○○○ 1.24 | 1.23734692702633 | 23637626 |
Retrieved 6 of 6 entries in 1.5 ms
(Link to these results)