Bacterial taxon 909946
Locus STM474_3674
Protein WP_000157589.1
[Fe-S]-dependent transcriptional repressor FeoC
Salmonella enterica Serovar Typhimurium ST4 74
Length 78 aa, Gene feoC, UniProt E8XEL0
>WP_000157589.1|Salmonella enterica Serovar Typhimurium ST4 74|[Fe-S]-dependent transcriptional repressor FeoC
MASLIQVRDLLALRGRMEATQISHTLHAPQPMIDAMLNQLEIMGKAVRIPEEPDGCLSGSCKSCPEGKACLREWWALR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,688,219 | -0.37 | 0.93 | ●○○○○ -0.02 | -0.0170516357574512 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,688,219 | 0.79 | 0.16 | ○○○○○ 0.59 | 0.586550718699338 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,688,219 | 1.57 | 0.43 | ○○○○○ 0.99 | 0.99345608594698 | 23637626 |
Retrieved 3 of 3 entries in 1.8 ms
(Link to these results)