Bacterial taxon 615
Locus BVG96_00865
Protein ASL96244.1
50S ribosomal protein L19
Serratia marcescens Strain UMH9
Length 118 aa, Gene n/a, UniProt n/a
>ASL96244.1|Serratia marcescens Strain UMH9|50S ribosomal protein L19
MSNIIKQLEQEQMKQDVPAFRPGDSVEVKVWVVEGSKKRLQAFEGVVIAIRNRGLHSAFTVRKISNGEGVERVFQTHSPVIDSIAVKRRGAVRKAKLYYLRERTGKAARIKERLNRVG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -2.74 | 0.0014 | ●●●●○ -3.25 | -3.2472165347581887 | 28536292 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)