Bacterial taxon 615
Locus BVG96_00790
Protein ASL96233.1
carbon storage regulator
Serratia marcescens Strain UMH9
Length 61 aa, Gene n/a, UniProt n/a
>ASL96233.1|Serratia marcescens Strain UMH9|carbon storage regulator
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQTTY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -3.11 | 0.0011 | ●●●●○ -3.67 | -3.668565741946716 | 28536292 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)