Bacterial taxon 615
Locus BVG96_21315
Protein ASL99998.1
diaminopimelate epimerase
Serratia marcescens Strain UMH9
Length 274 aa, Gene n/a, UniProt n/a
>ASL99998.1|Serratia marcescens Strain UMH9|diaminopimelate epimerase
MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHLGVGFDQMLVVEPPYDPELDFHYRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTQTGRMVLSVTDDDLVCVNMGEPNFDPQAVPFRAAKAEKTYIMRAAEHTVLCGVVSMGNPHCVLQVDDVKTAKVELLGPVLEGHERFPERANIGFMQVVSRDHIKLRVYERGAGETQACGSGACAAVAVGIQQELLSEEVHVELPGGSLHIRWKGPGNPLFMTGPATHVYDGFIHL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -2.35 | 0.0021 | ●●●○○ -2.8 | -2.7996900168816863 | 28536292 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)