Bacterial taxon 615
Locus BVG96_20075
Protein ASL99777.1
glycosyl transferase
Serratia marcescens Strain UMH9
Length 325 aa, Gene n/a, UniProt n/a
>ASL99777.1|Serratia marcescens Strain UMH9|glycosyl transferase
MNPQQPLLSVIVPFYNNEAFVIAALDSLFAQISDDIEVVIIDDGSTDASGALVSQYLAQRRHPRVVFTSQANGGIAHARNVGLRLATGRYITFLDGDDLLSDDYLAILRPQLTAGEYDLIDFNYQKFTEHPPTPDNRAARPVAYDFSQLGLGSLQSLFERSMWHLWSRVYKRTLLAGEAFEEGRRYEDVIFTPFQYFKTRRIAHLDGELYFYRDNSQGITRNIKPKDIEDMLFAMEKMLRFVAQHPGDEPLRRLAALMLANCFSEVKSMSKAVYGYYHYAPATLHILRRAADVCRNSDVPGKKVRQMRYARVDTFLSKLRGRRPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -4.45 | 2.1e-11 | ●●●●● -5.21 | -5.207404848919039 | 28536292 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)