Bacterial taxon 615
Locus BVG96_21250
Protein ASL99989.1
lipopolysaccharide N-acetylmannosaminouronosyltransferase
Serratia marcescens Strain UMH9
Length 246 aa, Gene n/a, UniProt n/a
>ASL99989.1|Serratia marcescens Strain UMH9|lipopolysaccharide N-acetylmannosaminouronosyltransferase
MEAKISVPQYELRGFSLWGFRDMAHCMDFLFDGGRVKQGTLVAMNAEKILKAEEDQALHALLDEAEYKYADGISMVRSIRRKYPAADVSRVAGADLWEALMQRAGREGTPVFLVGGKPEVLAETEQKLRSQWNVNLVGSQDGYFKPDQREALFERIRASGAAIVTVAMGSPKQEILMRDCRKVHPQALYMGVGGTYDVFTGHVKRAPKVWQNLGLEWLYRLLSQPSRIGRQLKLLKFVGYYYSGKM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 24 h | not available in this study | -3.42 | 1.8e-5 | ●●●●● -4.03 | -4.025618798752832 | 28536292 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)